Skip to product information
1 of 1

Gene Bio Systems

Recombinant Deinococcus radiodurans Uncharacterized protein DR_0893(DR_0893)

Recombinant Deinococcus radiodurans Uncharacterized protein DR_0893(DR_0893)

SKU:CSB-CF874294DJA

Regular price $1,840.00 USD
Regular price Sale price $1,840.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Uniprot NO.:Q9RVX8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKSMQQIAMTQQKTLDQVRTFMARTYSWMAAGLALTAGVAYLTAQNEGLAMQVASLRLP LMLAQLALVFVLSMFAQRLSAAVAGALFVGYAALTGLTFSALLFAYSPAAVITAFAVSAG TFGLMSVAGFVIKKDLSAMGRFFLFAVLGLVVAMLVNLFVGSSALSLGISMIGVFLFAGL TAYDTQMLRNLALSGISGEQAERASINGALALYLDFINIFLFLLNIGNSRD

Protein Names:Recommended name: Uncharacterized protein DR_0893

Gene Names:Ordered Locus Names:DR_0893

Expression Region:1-231

Sequence Info:full length protein

View full details