Skip to product information
1 of 1

Gene Bio Systems

Recombinant Deinococcus radiodurans Probable disulfide formation protein(DR_0754)

Recombinant Deinococcus radiodurans Probable disulfide formation protein(DR_0754)

SKU:CSB-CF879627DJA

Regular price $1,743.00 USD
Regular price Sale price $1,743.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Uniprot NO.:Q9RWB5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNRDTRLYLAWLVALAATLGSLYFSEIRHFNPCPLCWAQRIFMYPLAVILGIAAFVGDHG VRRYVLPLAALGLGFAIFQNLETWGFVQSIKACTVNAAAACNTPWPVWGTSQDTLNRALT IPVLSMIAFALILALLSWPRQRVTVPESAAVQG

Protein Names:Recommended name: Probable disulfide formation protein Alternative name(s): Disulfide oxidoreductase Thiol-disulfide oxidoreductase

Gene Names:Ordered Locus Names:DR_0754

Expression Region:1-153

Sequence Info:full length protein

View full details