Recombinant Debaryomyces hansenii ATP synthase subunit 9, mitochondrial(ATP9)

SKU: CSB-CF431501DIS

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Uniprot NO.:A9RAH4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQLALAAKYIGASMATLGLGGAAIGIALVFVALINGTSRNPSLRATLFPQAILGFALAEA CGLFCLMMSFLLLYAV

Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein

Gene Names:Name:ATP9

Expression Region:1-76

Sequence Info:full length protein