Skip to product information
1 of 1

Gene Bio Systems

Recombinant Daucus carota 14 kDa proline-rich protein DC2.15

Recombinant Daucus carota 14 kDa proline-rich protein DC2.15

SKU:CSB-CF318458DIR

Regular price $1,716.00 USD
Regular price Sale price $1,716.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Daucus carota (Carrot)

Uniprot NO.:P14009

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TEKCPDPYKPKPKPTPKPTPTPYPSAGKCPRDALKLGVCADVLNLVHNVVIGSPPTLPCC SLLEGLVNLEAAVCLCTAIKANILGKNLNLPIALSLVLNNCGKQVPNGFECT

Protein Names:Recommended name: 14 kDa proline-rich protein DC2.15

Gene Names:

Expression Region:26-137

Sequence Info:full length protein

View full details