Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Zinc finger protein-like 1(zfpl1)

Recombinant Danio rerio Zinc finger protein-like 1(zfpl1)

SKU:CSB-CF026462DIL

Regular price $2,005.00 USD
Regular price Sale price $2,005.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:P62447

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGLCKCPKKKVTNLFCFKHRVNVCEHCLVSNHNKCIVQSYLQWLQDSDYNPNCSLCIQPLDSQDTVRLVCYDLFHWSCLNELASHQPLNTAPDGYQCPTCQGPVFPPRNLASPVADMLREQLSSVNWARAGLGLPLIEDPEEEETTTHSGTSFSEWSTFETTSVDVSMSNPTLTSLPPHQDGEHIYNNREQSAPNNTVFNMVTTSATDTVTISTVTSPRKLYDTRDLGHSAVMQIDFDDDKYRRRPALNWFAQVLKNCTSTKKKTLALKHRIFLLLLFGVIGFFTLIIIMAKFGRASAETDPNLDPLLNPNIRIGNM

Protein Names:Recommended name: Zinc finger protein-like 1

Gene Names:Name:zfpl1 ORF Names:zgc:63760

Expression Region:1-317

Sequence Info:full length protein

View full details