Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio UPF0542 protein C5orf43 homolog (si:ch211-198n5.13, zgc:162244)

Recombinant Danio rerio UPF0542 protein C5orf43 homolog (si:ch211-198n5.13, zgc:162244)

SKU:CSB-CF384096DIL

Regular price $1,496.00 USD
Regular price Sale price $1,496.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:A3KNM5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFIASALLSWKLAKMIEAKDREQKKKQK RQENIAKAKRAKKD

Protein Names:Recommended name: UPF0542 protein C5orf43 homolog

Gene Names:ORF Names:si:ch211-198n5.13, zgc:162244

Expression Region:1-74

Sequence Info:full length protein

View full details