Gene Bio Systems
Recombinant Danio rerio UPF0197 transmembrane protein C11orf10 homolog(zgc:73269)
Recombinant Danio rerio UPF0197 transmembrane protein C11orf10 homolog(zgc:73269)
SKU:CSB-CF744100DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q6PBS6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFKAWFFVYEVTSTKYTRDVYKELLIALVA SLFMGFGVHFLLLWVGIFV
Protein Names:Recommended name: UPF0197 transmembrane protein C11orf10 homolog
Gene Names:ORF Names:zgc:73269
Expression Region:1-79
Sequence Info:full length protein
