Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Tumor necrosis factor(TNF superfamily, member 2)(tnfb),partial

Recombinant Danio rerio Tumor necrosis factor(TNF superfamily, member 2)(tnfb),partial

SKU:CSB-EP2355DIL1

Regular price $753.00 USD
Regular price Sale price $753.00 USD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: tnfb

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Danio rerio (Zebrafish) (Brachydanio rerio)

Delivery time: 3-7 business days

Uniprot ID: Q4W898

AA Sequence: AIHLHGDPSGQSLKWVGGVDQAFQQGGLRLENNEIIIPKDGLYFVYSQVSYETLCVEDVEGDGQKYLSHTINRYTDAVREKMPLQNSANSVCQSLDGKTSYSTIYLGAVFDLFGDDRLSTHTTRVGDIENNYAKTFFGVFAL

Tag info: N-terminal 6xHis-tagged

Expression Region: 101-242aa

Protein length: Partial

MW: 19.8 kDa

Alternative Name(s): tnf TNF alpha

Relevance:

Reference: "Mmp23b promotes liver development and hepatocyte proliferation through the tumor necrosis factor pathway in zebrafish." Qi F., Song J., Yang H., Gao W., Liu N.A., Zhang B., Lin S. Hepatology 52:2158-2166(2010)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details