Recombinant Danio rerio  Transmembrane protein 55B-A(tmem55ba)

Recombinant Danio rerio Transmembrane protein 55B-A(tmem55ba)

CSB-CF655595DIL
Regular price
$1,207.00 USD
Sale price
$1,207.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q32PR0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADGERSPLLSDLGDGALGSGNGGVSPGAASLGAPNKPQSFPPFPSSTQPPVLLSENPPP YSPLTSPESGSAPVISCRVCQSLISVEGKIHQHVVKCGVCNEATPIKNAPAGKKYVRCPC NCLLICKVTSQRIACPRPYCKRIINLGPVHPGPASPDPQPAGARVSCGHCSNTFLWTEFT DRTLARCPHCRKVSSIGQRYPRRRSLWCYLLCLLFSISAAGLIAGTWSQAQVYGGIYASW AAALLLVVLTLARALYWSCMRVSQPLHNLT

Protein Names:Recommended name: Transmembrane protein 55B-A EC= 3.1.3.- Alternative name(s): PtdIns-4,5-P2 4-Ptase I-A Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase-A

Gene Names:Name:tmem55ba ORF Names:zgc:123304

Expression Region:1-270

Sequence Info:full length protein

Your list is ready to share