Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Transmembrane protein 205(tmem205)

Recombinant Danio rerio Transmembrane protein 205(tmem205)

SKU:CSB-CF023799DIL

Regular price $1,789.00 USD
Regular price Sale price $1,789.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:A1L2F6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATEGDPTDFVKVLHLLVISFTWGMQVWVSFIAGFVLISQVSMHTFGLVQSKLFPVYFYC LLGGNAVSLAVYAVYHPRELLDWHEGIQMSLFFVAVIMAGLNAQWFGPSATENMLVMQEI EKEHGLGNQVGMSSNREGYTKLREQDPKYKEHRSTFYRYHGLSNLCNLIGFFCITVNLIY LALNLGTI

Protein Names:Recommended name: Transmembrane protein 205

Gene Names:Name:tmem205 ORF Names:zgc:158860

Expression Region:1-188

Sequence Info:full length protein

View full details