Gene Bio Systems
Recombinant Danio rerio Transmembrane protein 107(tmem107)
Recombinant Danio rerio Transmembrane protein 107(tmem107)
SKU:CSB-CF023676DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q6NZZ4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSALKSLVPARFLTLTAHLVIIITIFWSRDNNIQSCLPLEFTEDQYRTEDTRLTVALSVT LALFVLELAGFLSGVSMFNSNQALLSLITHSSACVCLSFFVFHQWPCWTYWIIFSICSVF PAVVELFLLLSQRVL
Protein Names:Recommended name: Transmembrane protein 107
Gene Names:Name:tmem107 ORF Names:zgc:77926
Expression Region:1-135
Sequence Info:full length protein
