Gene Bio Systems
Recombinant Danio rerio Reprimo-like protein(rprml)
Recombinant Danio rerio Reprimo-like protein(rprml)
SKU:CSB-CF020358DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:A5PLA0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MNGTFFNHTVFTHGVLLNRSQELAGTLVDCCTGNGSEVTANDGGGSLVLAQDERKLFVTR VVQIAVLCVLSLTVMFGIFFLGCNLMIKSESMINFLVKDRRSSKDVEAVMIGLS
Protein Names:Recommended name: Reprimo-like protein
Gene Names:Name:rprml ORF Names:zgc:165459
Expression Region:1-114
Sequence Info:full length protein
