Gene Bio Systems
Recombinant Danio rerio Oligosaccharyltransferase complex subunit ostc(ostc)
Recombinant Danio rerio Oligosaccharyltransferase complex subunit ostc(ostc)
SKU:CSB-CF801875DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q7ZWJ3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:METLFSLPFTVLECPNVKLKKPSWLHMPSAMTVYAVVIVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVSVLLSFFMARVFMRMKLPGYLMG
Protein Names:Recommended name: Oligosaccharyltransferase complex subunit ostc
Gene Names:Name:ostc ORF Names:zgc:56559
Expression Region:1-149
Sequence Info:full length protein
