Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Metallothionein-2(mt2)

Recombinant Danio rerio Metallothionein-2(mt2)

SKU:CSB-YP772046DIL

Regular price $1,364.00 USD
Regular price Sale price $1,364.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: Q7ZSY6

Gene Names: mt2

Organism: Danio rerio (Zebrafish) (Brachydanio rerio)

AA Sequence: MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ

Expression Region: 1-60aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 8 kDa

Alternative Name(s): MT-2

Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals.

Reference: "Expression of metallothionein gene during embryonic and early larval development in zebrafish."Chen W.-Y., John J.A.C., Lin C.-H., Lin H.-F., Wu S.-C., Lin C.-H., Chang C.-Y.Aquat. Toxicol. 69:215-227(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details