Gene Bio Systems
Recombinant Danio rerio Melatonin receptor type 1C(mtnr1c)
Recombinant Danio rerio Melatonin receptor type 1C(mtnr1c)
SKU:CSB-CF344310DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:P51052
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CHSLRYDRLYSRRNTCLYLLLTWMLTALATVPNFLVGSLKYDPRVFSCTFTQTASSSYTV CVVLIHFLVPLGVVSFCYLRIWTLVIRVKGRVRPNPKVRAADLRNFLTMFVVFVLFAVCW APLNFIGLAVAINPAKVAPNIPEWLFVTSYF
Protein Names:Recommended name: Melatonin receptor type 1C Short name= Mel-1C-R Short name= Mel1C receptor Alternative name(s): Melatonin receptor Mel1C Z2.3
Gene Names:Name:mtnr1c Synonyms:mel1c
Expression Region:1-151
Sequence Info:full length protein
