Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Lipoma HMGIC fusion partner-like 3 protein(lhfpl3)

Recombinant Danio rerio Lipoma HMGIC fusion partner-like 3 protein(lhfpl3)

SKU:CSB-CF738553DIL

Regular price $1,846.00 USD
Regular price Sale price $1,846.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6DHB5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPATEAAKIYQTNYVRNSRAIGVLWAIFTTLFAIVNVVCFVQPYWIGDGMDTPQAGYFG LFHYCIGSGMSRDLTCQGSFTEFGSIPSSAFKAASFFIGMSMVLVLSCIGCFALFFFCST ATVYKICGWMQLAAGTCLVLGCMIYPDGWDADEVKRMCGEGTDKYTIGACSVRWAYILAI MGILDALILSFLAFVLGNRQDGLMSEELLGDKSGNA

Protein Names:Recommended name: Lipoma HMGIC fusion partner-like 3 protein

Gene Names:Name:lhfpl3 ORF Names:zgc:92534

Expression Region:1-216

Sequence Info:full length protein

View full details