Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Immediate early response 3-interacting protein 1(ier3ip1)

Recombinant Danio rerio Immediate early response 3-interacting protein 1(ier3ip1)

SKU:CSB-CF687181DIL

Regular price $1,658.00 USD
Regular price Sale price $1,658.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q4VBI2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFTLYALIQTAILFTNAIAVLHEERFLSKIGWGAEQGVGGFGDDPGIKAQLLNLIRSVR TVMRVPLIAVNSVCIVLLLLFG

Protein Names:Recommended name: Immediate early response 3-interacting protein 1

Gene Names:Name:ier3ip1 ORF Names:zgc:112367

Expression Region:1-82

Sequence Info:full length protein

View full details