Gene Bio Systems
Recombinant Danio rerio Immediate early response 3-interacting protein 1(ier3ip1)
Recombinant Danio rerio Immediate early response 3-interacting protein 1(ier3ip1)
SKU:CSB-CF687181DIL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Danio rerio (Zebrafish) (Brachydanio rerio)
Uniprot NO.:Q4VBI2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAFTLYALIQTAILFTNAIAVLHEERFLSKIGWGAEQGVGGFGDDPGIKAQLLNLIRSVR TVMRVPLIAVNSVCIVLLLLFG
Protein Names:Recommended name: Immediate early response 3-interacting protein 1
Gene Names:Name:ier3ip1 ORF Names:zgc:112367
Expression Region:1-82
Sequence Info:full length protein
