Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio E3 ubiquitin-protein ligase MARCH2(41335)

Recombinant Danio rerio E3 ubiquitin-protein ligase MARCH2(41335)

SKU:CSB-CF638064DIL

Regular price $1,865.00 USD
Regular price Sale price $1,865.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q1LVZ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTGECCHLPGSLCDCTGNAALSKTVEEADNRRAQYVTQVTAKDGRLLSTVIKALGTQSD RPICRICHEGQDVCNSEGLLSPCDCTGTLGTVHKSCLEKWLSSSNTSYCELCHTEFTIER RPRPLTEWLRDPGPRNEKRTLFCDMVCFLFITPLAAISGWLCLRGAQDHLHFNSRLEAVG LIALTIALFTIYVLWTLVSFRYHCQLYSEWRRTNQKVRLLIPDTKGAHSTQHSLLSTKLL KKTADETIV

Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH2 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II Short name= MARCH-II

Gene Names:Name:march2 ORF Names:si:ch211-197g15.3, zgc:158704

Expression Region:1-249

Sequence Info:full length protein

View full details