Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Cortexin-2(ctxn2)

Recombinant Danio rerio Cortexin-2(ctxn2)

SKU:CSB-CF704545DIL

Regular price $1,507.00 USD
Regular price Sale price $1,507.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q592E4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCSVHYNHSLAAMSGSDIMAYSLSLEQKTAFAFVGMLLVFLGLLIVRCFRILLDPYSSMP SSSWGDGLEGLEKGTFEYALT

Protein Names:Recommended name: Cortexin-2

Gene Names:Name:ctxn2 ORF Names:wu:fj35c01

Expression Region:1-81

Sequence Info:full length protein

View full details