Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Calcium release-activated calcium channel protein 1(orai1)

Recombinant Danio rerio Calcium release-activated calcium channel protein 1(orai1)

SKU:CSB-CF761459DIL

Regular price $1,832.00 USD
Regular price Sale price $1,832.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6TLE6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKMSRSEHSLQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTNHDYPPGLLI AFSACTTVLVAVHLFALMVSTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTV IGTLLFLAGVVLLCWVKFLPIKPKGQKNGTVSAGVAAAITSTSIMVPFGLVFIVFAVHFY RSLVSHKTDRQFQELEELEDLQNELDHREEVSTLQSPGSLYP

Protein Names:Recommended name: Calcium release-activated calcium channel protein 1 Alternative name(s): Protein orai-1 Transmembrane protein 142A

Gene Names:Name:orai1 Synonyms:tmem142a ORF Names:zgc:109721

Expression Region:1-222

Sequence Info:full length protein

View full details