Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Apoptosis-related protein 3(apr3)

Recombinant Danio rerio Apoptosis-related protein 3(apr3)

SKU:CSB-CF003836DIL

Regular price $1,862.00 USD
Regular price Sale price $1,862.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:A3KNS9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QDTDAQLCQMCEGTIRHDSPVWSFCITKGYVKGHCCFKNNTSDVDTIIGLDLSNCSISHVEHLYNSSTALIIDLSNNPISNLSDYVFQGFSQLTQLLLPSKLECPGGRASWEKVEVKSITRICEGQKNACNQTVQMPLVCPENSLCSPYGPGFFECSCLNNFHGYKCMRQGEFPLVKVLGILTASTVVVSSVLWFTQRRKVKNT

Protein Names:Recommended name: Apoptosis-related protein 3 Short name= APR-3

Gene Names:Name:apr3 ORF Names:si:ch211-101l18.3

Expression Region:27-230

Sequence Info:full length protein

View full details