Skip to product information
1 of 1

Gene Bio Systems

Recombinant Danio rerio Ankyrin repeat domain-containing protein 46(ankrd46)

Recombinant Danio rerio Ankyrin repeat domain-containing protein 46(ankrd46)

SKU:CSB-CF757762DIL

Regular price $1,674.00 USD
Regular price Sale price $1,674.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Danio rerio (Zebrafish) (Brachydanio rerio)

Uniprot NO.:Q6TNT2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSYVFINDSSQTSVPLLQACIDGDLSFARRLLETGCDPNIRDHRGRTGLHLAAARGNVDI CRFLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHNGSTPLVLAKRRGV NKDAIRLLEGLEEQEVKGFNRGAHSKLEAMQMAESESAMESHSLLNPNLQNSEGVLSSFR STWQEFVEDLGFWRVLLLLVVIALLSLGIAYYVSGVLPFSASQLELVH

Protein Names:Recommended name: Ankyrin repeat domain-containing protein 46

Gene Names:Name:ankrd46 ORF Names:zgc:109722

Expression Region:1-228

Sequence Info:full length protein

View full details