Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cyanidioschyzon merolae Tic20 family protein Ycf60(ycf60)

Recombinant Cyanidioschyzon merolae Tic20 family protein Ycf60(ycf60)

SKU:CSB-CF768080DZU

Regular price $1,801.00 USD
Regular price Sale price $1,801.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cyanidioschyzon merolae (Red alga)

Uniprot NO.:Q85G30

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWIIIASYGVLIIVLAIGIGVGVGVIRKVLKKGMKAEMTIGERMLCFGYYLLPVLECMTH CGPDVLNGWMKGLYKRSLGDLVVVYSTYPILGFMIFFMSYFLLVRGILQVRKKVRFHVSQ ALIIYLLTSIIGSLLNALPEMILMGWFGSTCLDILFILTMGSVIYASYQVWNGELTRLPL ISEAAKLQVQDGEGEKK

Protein Names:Recommended name: Tic20 family protein Ycf60

Gene Names:Name:ycf60

Expression Region:1-197

Sequence Info:full length protein

View full details