Skip to product information
1 of 1

Gene Bio Systems

Recombinant Culex quinquefasciatus UPF0443 protein CPIJ008582 (CPIJ008582)

Recombinant Culex quinquefasciatus UPF0443 protein CPIJ008582 (CPIJ008582)

SKU:CSB-CF537745DZM

Regular price $1,623.00 USD
Regular price Sale price $1,623.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Culex quinquefasciatus (Southern house mosquito) (Culex pungens)

Uniprot NO.:B0WN94

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRKLRGGQTRETRKQKQERREENQKIQQQLKTIVLPICGVVFLCIVAYVFLKTRPRFEEL

Protein Names:Recommended name: UPF0443 protein CPIJ008582

Gene Names:ORF Names:CPIJ008582

Expression Region:1-60

Sequence Info:full length protein

View full details