Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11(S11)

Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11(S11)

SKU:CSB-CF737603CFAT

Regular price $1,654.00 USD
Regular price Sale price $1,654.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cryphonectria parasitica mycoreovirus 1 (strain 9B21) (CpMYRV-1)

Uniprot NO.:Q65YU5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IEDFDTHYTKKIREFLLFIIHTSCTMVAFIIGNLAMTRPRRTHHNTITAPDETIHDDILL PPAYKSLASAPALGIKMV

Protein Names:Recommended name: Uncharacterized protein VP11

Gene Names:Name:S11

Expression Region:24-101

Sequence Info:full length protein

View full details