Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Crotalus viridis viridis (Prairie rattlesnake)
Uniprot NO.:Q95776
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTHQHLLTMFNLLPVGXNISTWWNFGSMLLSCLTIQIITGFFLAIHYTANINMAFSSIMH ISRDVPYGWIMQNTHAIGXSLFFICIYIHIARGIYYGSYLNKEVWLSGTTLLITLMATAS XXMCYHDT
Protein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit
Gene Names:Name:MT-CYB Synonyms:COB, CYTB, MTCYB
Expression Region:1-128
Sequence Info:full length protein