Skip to product information
1 of 1

GeneBio Systems

Recombinant Crotalus atrox Phospholipase A2, partial

Recombinant Crotalus atrox Phospholipase A2, partial

SKU:P0CV89

Regular price $1,075.00 USD
Regular price Sale price $1,075.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P0CV89

Gene Names: N/A

Alternative Name(s): Phosphatidylcholine 2-acylhydrolase

Abbreviation: Recombinant Crotalus atrox Phospholipase A2 protein, partial

Organism: Crotalus atrox (Western diamondback rattlesnake)

Source: E.coli

Expression Region: 1-61aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: NLLQFNKMIKIMTKKNAFPFYTSYGCYCGWGGRCCFVHDCCYEKTDIYSYSWKRQICECDR

MW: 14.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Snake venom phospholipase A2 (PLA2) that displays edema-inducing activities. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Reference: "Exploring the venom proteome of the western diamondback rattlesnake, Crotalus atrox, via snake venomics and combinatorial peptide ligand library approaches." Calvete J.J., Fasoli E., Sanz L., Boschetti E., Righetti P.G. J. Proteome Res. 8: 3055-3067(2009)

Function:

View full details