Gene Bio Systems
Recombinant Cronobacter sakazakii UPF0756 membrane protein ESA_02180 (ESA_02180)
Recombinant Cronobacter sakazakii UPF0756 membrane protein ESA_02180 (ESA_02180)
SKU:CSB-CF419128CXL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Uniprot NO.:A7MN87
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFDITLLILLALAGLGFVSHNMAVTVSVLVLIVIRMTPLSAWFPWVEKQGVTVGIIILTI SVMAPIASGTLPTSTLFHAFLNWKSLVAIAVGVFVSWLGGKGVALMGSQPSIVAGLLVGT VLGVALFRGVPVGPLIAAGLVSLLIGRQ
Protein Names:Recommended name: UPF0756 membrane protein ESA_02180
Gene Names:Ordered Locus Names:ESA_02180
Expression Region:1-148
Sequence Info:full length protein
