Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Uniprot NO.:P51057
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDMVDRTSRRGYRDWFVQRITALLSGIYAVFVIVFLLVHHPISYPQWHALFSHLIMKIFT LIVIFSILWHAWIGMWTIFTDYVKNKPIRLALETLVCLLLVGYFVWAIEFLWIAR
Protein Names:Recommended name: Succinate dehydrogenase hydrophobic membrane anchor subunit
Gene Names:Name:sdhD Ordered Locus Names:CBU_1402
Expression Region:1-115
Sequence Info:full length protein