Gene Bio Systems
Recombinant Coxiella burnetii Protein CrcB homolog(crcB)
Recombinant Coxiella burnetii Protein CrcB homolog(crcB)
SKU:CSB-CF433703DXO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Coxiella burnetii (strain Dugway 5J108-111)
Uniprot NO.:A9KG69
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNVLLIFLGCGAGGVARYGVSNLMYLLMGKQFPIGTLIVNITGSLLMGILFIFILERLSG NIQLWRSLLLIGFLGGYTTFSSFSIETFNLIEAGHYFGAALNVLLSVALCIAGAWLGVLI GRQL
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:CBUD_1038
Expression Region:1-124
Sequence Info:full length protein
