Skip to product information
1 of 1

Gene Bio Systems

Recombinant Corynebacterium glutamicum Uncharacterized membrane protein Cgl2017-cg2211(Cgl2017, cg2211)

Recombinant Corynebacterium glutamicum Uncharacterized membrane protein Cgl2017-cg2211(Cgl2017, cg2211)

SKU:CSB-CF850942DWY

Regular price $1,738.00 USD
Regular price Sale price $1,738.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Uniprot NO.:Q8NP09

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGSSHTIEPEIYRGVSTLDEPSAAWGWHGLKRNTIQLAGWISVLFMLGYNFGNHKGHVE TIWLLVITALLVIGLLIHLFEPKLSQVRTITSRNKPVGHVEPDWTYDQATLTGTWGNLTD SQLRSVNIEPSRVAHLRAADSAKELDN

Protein Names:Recommended name: Uncharacterized membrane protein Cgl2017/cg2211 Short name= P20

Gene Names:Ordered Locus Names:Cgl2017, cg2211

Expression Region:1-147

Sequence Info:full length protein

View full details