Skip to product information
1 of 1

Gene Bio Systems

Recombinant Corynebacterium glutamicum Lysine exporter protein(lysE)

Recombinant Corynebacterium glutamicum Lysine exporter protein(lysE)

SKU:CSB-CF309427DWY

Regular price $1,907.00 USD
Regular price Sale price $1,907.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Uniprot NO.:P94633

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIFITGLLLGASLLLSIGPQNVLVIKQGIKREGLIAVLLVCLISDVFLFIAGTLGVDLL SNAAPIVLDIMRWGGIAYLLWFAVMAAKDAMTNKVEAPQIIEETEPTVPDDTPLGGSAVA TDTRNRVRVEVSVDKQRVWVKPMLMAIVLTWLNPNAYLDAFVFIGGVGAQYGDTGRWIFA AGAFAASLIWFPLVGFGAAALSRPLSSPKVWRWINVVVAVVMTALAIKLMLMG

Protein Names:Recommended name: Lysine exporter protein

Gene Names:Name:lysE Ordered Locus Names:Cgl1262, cg1424

Expression Region:1-233

Sequence Info:full length protein

View full details