Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Coccidioides immitis (strain RS) (Valley fever fungus)
Uniprot NO.:Q1DME3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:STSAGSTLGDRIGQMYRAHLSKHPFLLFGLPFLSLMVAGSFVLTPATALRYERHDRKVQQ VSQQEALALGIKGPDGDGENDIKMNPRRRVLGSEKEEYYRLMAKDLDNWEQKRVQRWKGE PDGRLS
Protein Names:Recommended name: Cytochrome c oxidase assembly protein COX16, mitochondrial
Gene Names:Name:COX16 ORF Names:CIMG_08520
Expression Region:12-137
Sequence Info:full length protein