
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: Rd
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Clostridium pasteurianum
Delivery time: 3-7 business days
Uniprot ID: P00268
AA Sequence: MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-54aa
Protein length: Full Length
MW: 22 kDa
Alternative Name(s): Short name:Rd
Relevance: Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule.
Reference: "Cloning, sequencing and expression in Escherichia coli of the rubredoxin gene from Clostridium pasteurianum."Mathieu I., Meyer J., Moulis J.-M.Biochem. J. 285:255-262(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Clostridium pasteurianum Rubredoxin(Rd)
- Regular price
- $911.00 USD
- Sale price
- $911.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli CS6 fimbrial subunit B(cssB)
- Regular price
- $911.00 USD
- Sale price
- $911.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Claudin-3(CLDN3),partial
- Regular price
- $685.00 USD
- Sale price
- $685.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Oncomodulin(Ocm)
- Regular price
- $775.00 USD
- Sale price
- $775.00 USD
- Regular price
-
- Unit price
- per
Sold out