Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium kluyveri Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

Recombinant Clostridium kluyveri Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

SKU:CSB-CF402848CWX

Regular price $1,889.00 USD
Regular price Sale price $1,889.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Uniprot NO.:A5N4S9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKDITIGQYVPGDSFIHKLDPRVKILISLIYIVDLFIVNSFKGYIFIVVFTLISILVSK VQFTYIYKGLKPIFILVLITAVLNIFMTGGANPPLFKWKFLVVYREGLIMAAFMALRLVF LIIGTSLLTLTTSPIELTDGIEKLLKPVSKIGVPSHELAMMMTIALRFIPTLMDETDKIM KAQIARGADLESGNLIQKAKNLVPILVPLFISSFRRADELAMAMEARCYRGGDGRTRMKE LKLSNRDFIASLCALVLVCISILSRIWWGK

Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein EcfT Short name= ECF transporter T component EcfT

Gene Names:Name:ecfT Ordered Locus Names:CKL_0256

Expression Region:1-270

Sequence Info:full length protein

View full details