Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium botulinum UPF0316 protein CLM_0701 (CLM_0701)

Recombinant Clostridium botulinum UPF0316 protein CLM_0701 (CLM_0701)

SKU:CSB-CF500345DUH

Regular price $1,766.00 USD
Regular price Sale price $1,766.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Clostridium botulinum (strain Kyoto / Type A2)

Uniprot NO.:C1FT66

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK

Protein Names:Recommended name: UPF0316 protein CLM_0701

Gene Names:Ordered Locus Names:CLM_0701

Expression Region:1-170

Sequence Info:full length protein

View full details