
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Uniprot NO.:Q97I14
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLGVIVACMQDMSSYMFGQWDTPLMVLIFFMVIDYLGDIVNAAVEKSLDFKKSYMGIAKI VSVLVVIIVSVLMDRLVNKGTWFFRTFTCYFYVANEGINILENCSKLGLPMPEKLMKTLE DLKNR
Protein Names:Recommended name: Uncharacterized protein CA_C1842
Gene Names:Ordered Locus Names:CA_C1842
Expression Region:1-125
Sequence Info:full length protein