Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium acetobutylicum Probable sporulation sigma-E factor-processing peptidase(spoIIGA)

Recombinant Clostridium acetobutylicum Probable sporulation sigma-E factor-processing peptidase(spoIIGA)

SKU:CSB-CF674934DUB

Regular price $1,884.00 USD
Regular price Sale price $1,884.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Uniprot NO.:Q45832

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVIYLDVLIFENSIVNTFLLYITAQTLRIKVKMRYLILAGIFGGLYVIVLVIPTLKIFSS LIFKIIAAFLMIIICFRKKSLRFNIKALAVLIMYSMVTAGLCFFIELNNTRGSYFNAFIG NVSYKWILIAIMIIYMFVNRIIWFINDRKLTQSLIYEIEICFKDNSKFINAFLDTGNELR EPITNLPVIVVEKDMVSGIKWDDCPKFYVPFRLFNGKAGNLEAFKPSYVKIYIGDKVEVR NAIIALIDNKLSSLNDYNALLSRGSI

Protein Names:Recommended name: Probable sporulation sigma-E factor-processing peptidase EC= 3.4.23.- Alternative name(s): Stage II sporulation protein GA

Gene Names:Name:spoIIGA Ordered Locus Names:CA_C1694

Expression Region:1-266

Sequence Info:full length protein

View full details