Skip to product information
1 of 1

Gene Bio Systems

Recombinant Citrobacter koseri UPF0266 membrane protein CKO_01158 (CKO_01158)

Recombinant Citrobacter koseri UPF0266 membrane protein CKO_01158 (CKO_01158)

SKU:CSB-CF426266CWS

Regular price $1,746.00 USD
Regular price Sale price $1,746.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Uniprot NO.:A8AFN6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTVTDLVLVLFIVALLAYAIYDQFIMPRRNGPTLLAVPLLRRGRVDSVIFVGLVAILIYN NVTSHGAQITTWLLCALALMGFYIFWVRAPRIIFKQKGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLERIYKLLVSSQ

Protein Names:Recommended name: UPF0266 membrane protein CKO_01158

Gene Names:Ordered Locus Names:CKO_01158

Expression Region:1-152

Sequence Info:full length protein

View full details