Recombinant Chloroflexus aurantiacus  Sec-independent protein translocase protein TatA(tatA)

Recombinant Chloroflexus aurantiacus Sec-independent protein translocase protein TatA(tatA)

CSB-CF434251DSX
Regular price
$1,063.00 USD
Sale price
$1,063.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

Uniprot NO.:A9WK61

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIGGLGWGELLIILIIVIAIFGAGKLAGLGGALGSSIREFRKAVKGDDEPRSDAKTEGET KV

Protein Names:Recommended name: Sec-independent protein translocase protein TatA

Gene Names:Name:tatA Ordered Locus Names:Caur_1284

Expression Region:1-62

Sequence Info:full length protein