Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydophila caviae Sulfur-rich protein(srp)

Recombinant Chlamydophila caviae Sulfur-rich protein(srp)

SKU:CSB-CF310171DSL

Regular price $1,756.00 USD
Regular price Sale price $1,756.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlamydophila caviae (strain GPIC)

Uniprot NO.:P94665

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLTGVENSESGVIDLIKPGLDDVMKNETVQVTLVNSVLGWCKAHIVDPIKTSKIVQSRAF QITMVVLGVILLIAGLALTFVLQGQLGKNAFLFLIPAVIGLVKLLTTSVFMEKPCTPEKW RLCKRLLATTEDILDDGQINQSNTIFTTESSDVTNTATQS

Protein Names:Recommended name: Sulfur-rich protein

Gene Names:Name:srp Ordered Locus Names:CCA_00186

Expression Region:1-160

Sequence Info:full length protein

View full details