Skip to product information
1 of 1

GeneBio Systems

Recombinant Chlamydomonas moewusii DNA endonuclease I-CeuI

Recombinant Chlamydomonas moewusii DNA endonuclease I-CeuI

SKU:P32761

Regular price $1,069.00 USD
Regular price Sale price $1,069.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P32761

Gene Names: N/A

Alternative Name(s): (23S rRNA intron 1 protein)

Abbreviation: Recombinant Chlamydomonas moewusii DNA endonuclease I-CeuI protein

Organism: Chlamydomonas moewusii (Chlamydomonas eugametos)

Source: E.coli

Expression Region: 1-218aa

Protein Length: Full Length

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: MSNFILKPGEKLPQDKLEELKKINDAVKKTKNFSKYLIDLRKLFQIDEVQVTSESKLFLAGFLEGEASLNISTKKLATSKFGLVVDPEFNVTQHVNGVKVLYLALEVFKTGRIRHKSGSNATLVLTIDNRQSLEEKVIPFYEQYVVAFSSPEKVKRVANFKALLELFNNDAHQDLEQLVNKILPIWDQMRKQQGQSNEGFPNLEAAQDFARNYKKGIK

MW: 29.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Endonuclease involved in intron homing. Recognizes a degenerate sequence of 17-19 bp to produce a staggered cut 5 bp downstream from the CeLSU.5 intron insertion site.

Reference: "The structure of I-CeuI homing endonuclease: evolving asymmetric DNA recognition from a symmetric protein scaffold." Spiegel P.C., Chevalier B., Sussman D., Turmel M., Lemieux C., Stoddard B.L. Structure 14: 869-880(2006)

Function:

View full details