Gene Bio Systems
Recombinant Chlamydia trachomatis UPF0092 membrane protein CT_741 (CT_741)
Recombinant Chlamydia trachomatis UPF0092 membrane protein CT_741 (CT_741)
SKU:CSB-CF525940DSB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chlamydia trachomatis (strain D/UW-3/Cx)
Uniprot NO.:O84746
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYSRLFFSILFFLGCCPALFADTDSPQRATFGQPAVMLGIAIVFFYFILWRPEQKRRQAM EKRKSELAVGDKVTAMGIVGTIAEIREHTVILNIASGKIEILKAAISEILKAEK
Protein Names:Recommended name: UPF0092 membrane protein CT_741
Gene Names:Ordered Locus Names:CT_741
Expression Region:1-114
Sequence Info:full length protein
