Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydia trachomatis Uncharacterized protein CT_006 (CT_006)

Recombinant Chlamydia trachomatis Uncharacterized protein CT_006 (CT_006)

SKU:CSB-CF526994DSB

Regular price $1,788.00 USD
Regular price Sale price $1,788.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chlamydia trachomatis (strain D/UW-3/Cx)

Uniprot NO.:O84009

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPSTVAPIKGQDHFLNLVFPERVAAAYMSPLAQKYPKAALSIASLAGFLLGILKLITFPV LCAAGLFVFPIRGLISCLFHKSFQGCSGYVLATFLSLFSLALTIVGIVSCITWAPGFIFP MISVSIAFATVETCFQIYTHLFPALEHKPSSSLKIEIAAAKLPRSSSAPDLNYPSLPTQS ASPSQRFSA

Protein Names:Recommended name: Uncharacterized protein CT_006

Gene Names:Ordered Locus Names:CT_006

Expression Region:1-189

Sequence Info:full length protein

View full details