Recombinant Chlamydia muridarum  UPF0092 membrane protein TC_0117(TC_0117)

Recombinant Chlamydia muridarum UPF0092 membrane protein TC_0117(TC_0117)

CSB-CF868614CIU
Regular price
$1,076.00 USD
Sale price
$1,076.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlamydia muridarum (strain MoPn / Nigg)

Uniprot NO.:Q9PLI2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSRVLFSILFFLGCCPSLFADVDSPQRATFGQPAVMLGIAIVFFYFILWRPEQKRRQAM EKRKSELAVGDKVTAMGIVGTIAEIREHTVVLNIASGKIEILKAAISEIFKAEK

Protein Names:Recommended name: UPF0092 membrane protein TC_0117

Gene Names:Ordered Locus Names:TC_0117

Expression Region:1-114

Sequence Info:full length protein