Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydia muridarum Probable disulfide formation protein(TC_0448)

Recombinant Chlamydia muridarum Probable disulfide formation protein(TC_0448)

SKU:CSB-CF889386CIU

Regular price $1,722.00 USD
Regular price Sale price $1,722.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlamydia muridarum (strain MoPn / Nigg)

Uniprot NO.:Q9PKL7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKLLRSYCLYFAWLVSCIGTLMSVYYSYLLNVEPCVLCYYQRICLFPLVVILGISAYLD DLSVKIYALPLALIGFCIAIYQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASALA FFAIANLLIFATKSE

Protein Names:Recommended name: Probable disulfide formation protein Alternative name(s): Disulfide oxidoreductase Thiol-disulfide oxidoreductase

Gene Names:Ordered Locus Names:TC_0448

Expression Region:1-135

Sequence Info:full length protein

View full details