Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken UPF0444 transmembrane protein C12orf23 homolog(RCJMB04_6o13)

Recombinant Chicken UPF0444 transmembrane protein C12orf23 homolog(RCJMB04_6o13)

SKU:CSB-CF730516CH

Regular price $1,738.00 USD
Regular price Sale price $1,738.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5ZLA9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNQTDKSHQEVPSYLHDEPPEGSIKDHPQQQPSMLSRVTGGIFSVTKGAVGATIGGVAWI GGKSLEITKTAVTSVPSMGVGLVKGSVSAVAGGVTAVGSAVASKVPLTGKKKDKSD

Protein Names:Recommended name: UPF0444 transmembrane protein C12orf23 homolog

Gene Names:ORF Names:RCJMB04_6o13

Expression Region:1-116

Sequence Info:full length protein

View full details