Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Leukocyte cell-derived chemotaxin 1(LECT1)

Recombinant Chicken Leukocyte cell-derived chemotaxin 1(LECT1)

SKU:CSB-CF865518CH

Regular price $1,724.00 USD
Regular price Sale price $1,724.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q9PUU8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:EMKRNKRQSESNFDAEHRAAAAEEVNTRSTPTQLTQDLGPQSNETRPMQQESDQTLNPDN PYNQLEGEGMAFDPMLDHLGVCCIECRRSYTQCQRICEPLLGYYPWPYNYQGCRTACRII MPCSWWVARIMGVV

Protein Names:Recommended name: Leukocyte cell-derived chemotaxin 1 Cleaved into the following 2 chains: 1. Chondrosurfactant protein Short name= 2. CH-SP 3. Chondromodulin-1 Alternative name(s): Chondromodulin-I Short name= ChM-I

Gene Names:Name:LECT1 Synonyms:CHMI

Expression Region:214-347

Sequence Info:full length protein

View full details