Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Heme transporter HRG1(SLC48A1)

Recombinant Chicken Heme transporter HRG1(SLC48A1)

SKU:CSB-CF726476CH

Regular price $1,738.00 USD
Regular price Sale price $1,738.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5ZHU0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVSRALALRLAYAAAGALMGFSAFFTWSLAPAFRQPATAAAGGLSGVLALWALITHVMY VQDYWRTWLKGLRFFLFIGILFSALSVVGFCTFLVLAITQHQSLTDPRSYYLSCVWSFIS LKWAFLLSLYAYRYRNEFADISILSDF

Protein Names:Recommended name: Heme transporter HRG1 Alternative name(s): Heme-responsive gene 1 protein homolog Short name= HRG-1 Solute carrier family 48 member 1

Gene Names:Name:SLC48A1 Synonyms:HRG1 ORF Names:RCJMB04_33e14

Expression Region:1-147

Sequence Info:full length protein

View full details