Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1)

Recombinant Chicken Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1)

SKU:CSB-CF716990CH

Regular price $1,799.00 USD
Regular price Sale price $1,799.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5ZLR5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFIS SLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDP QHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNL EVPTYQFVGDDLVVVG

Protein Names:Recommended name: Cytochrome b-c1 complex subunit Rieske, mitochondrial EC= 1.10.2.2 Alternative name(s): Complex III subunit 5 Rieske iron-sulfur protein Short name= RISP Ubiquinol-cytochrome c reductase iron-sulfur subunit

Gene Names:Name:UQCRFS1 ORF Names:RCJMB04_5b19

Expression Region:77-272

Sequence Info:full length protein

View full details